PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g046360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 381aa    MW: 42754.3 Da    PI: 8.2029
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g046360.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.52.9e-1938127495
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     + +++ +l+++ l+lp +f++++++k ++  +++l+d + rsW + l+++k sg++++++GWk+F+++ng ++g f++Fkl ++ +++++++
  Csa16g046360.1  38 AHVTAASLETDALYLPQDFTSSNDLKRKC-CKIVLKDGEERSWAMDLRFNKLSGTCYISRGWKHFCDENGKNAGSFFTFKLLEN-GETPLLS 127
                     556788899999***********999655.6*************************************************9874.4445555 PP

2B360.13.8e-19160252197
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+lks+rl+lp +f++e+g++  +++++tl  ++g +W  +l  r +sgr+ l+kG k+F +angLk g++++++l++ +++++v+ 
  Csa16g046360.1 160 FVTLTLTNDNLKSSRLYLPLPFVRENGMN--NPRMVTLLGKDGIRWAANL-LRENSGRMSLGKGMKDFSRANGLKIGESFTLELIW-ENATPVLN 250
                     7788899*******************999..5669***************.799999*****************************.77778887 PP

                     EE CS
              B3  96 vf 97 
                     +f
  Csa16g046360.1 251 LF 252
                     76 PP

3B365.67.2e-21262355198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+l+++rl lp +f++e++++k++  ++tl  ++g +W  +l  + ++gr+ l+kGWkeF+kangL++g +++++ ++ ++++++++
  Csa16g046360.1 262 FVTLTVTHDSLNNNRLGLPLSFMRENDMNKPG--KITLLGKDGTKWIANL-LQESRGRMSLGKGWKEFAKANGLEVGVSFTLESIW-EDTTPMLG 352
                     788899********************999766..7***************.7999999*************************999.88889999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  Csa16g046360.1 353 LFS 355
                     986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.5E-1830126IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-1934134IPR015300DNA-binding pseudobarrel domain
CDDcd100177.09E-1635128No hitNo description
SMARTSM010191.2E-2035132IPR003340B3 DNA binding domain
PROSITE profilePS5086313.63435132IPR003340B3 DNA binding domain
PfamPF023629.4E-1838125IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.1E-19151249IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.02E-19157254IPR015300DNA-binding pseudobarrel domain
CDDcd100172.31E-18159253No hitNo description
SMARTSM010191.5E-27160255IPR003340B3 DNA binding domain
PfamPF023627.8E-19160252IPR003340B3 DNA binding domain
PROSITE profilePS5086313.803160255IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-18256350IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20259351IPR015300DNA-binding pseudobarrel domain
CDDcd100173.47E-18261355No hitNo description
SMARTSM010192.4E-27262357IPR003340B3 DNA binding domain
PfamPF023621.5E-20262355IPR003340B3 DNA binding domain
PROSITE profilePS5086314.677262357IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MMIEEASDHQ DNKIEFQRKK KVKQNNPETE ADSSCFVAHV TAASLETDAL YLPQDFTSSN  60
DLKRKCCKIV LKDGEERSWA MDLRFNKLSG TCYISRGWKH FCDENGKNAG SFFTFKLLEN  120
GETPLLSVWP TKSDNDRAQG DNNSSQSDRD STSPPNRNRF VTLTLTNDNL KSSRLYLPLP  180
FVRENGMNNP RMVTLLGKDG IRWAANLLRE NSGRMSLGKG MKDFSRANGL KIGESFTLEL  240
IWENATPVLN LFCKEVKIQN RFVTLTVTHD SLNNNRLGLP LSFMRENDMN KPGKITLLGK  300
DGTKWIANLL QESRGRMSLG KGWKEFAKAN GLEVGVSFTL ESIWEDTTPM LGLFSIESTS  360
DKRQQGECCS NASENSSIST *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472480.10.0PREDICTED: B3 domain-containing protein REM12-like
SwissprotP0CAP41e-110REM12_ARATH; B3 domain-containing protein REM12
TrEMBLM4C8L71e-169M4C8L7_BRARP; Uncharacterized protein
STRINGBra000545.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.11e-111B3 family protein